NSJ Bioreagents

TREX1 Antibody

Product Code:
 
NSJ-R32336
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the TREX1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of human SMMC cell lysate with TREX1 antibody. Expected/observed molecular weight ~39/32/33 kDa (isoforms 1/2/3).
❮❯

Western blot testing of human SMMC cell lysate with TREX1 antibody. Expected/observed molecular weight ~39/32/33 kDa (isoforms 1/2/3).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32336-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the TREX1 antibody should be determined by the researcher.
Description:
Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DDNLANLLLAFLRRQPQPWCLVAHNGDRYD of human TREX1 were used as the immunogen for the TREX1 antibody.
Limitation:
This TREX1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q9NSU2