NSJ Bioreagents

TFPI2 Antibody

Product Code:
 
NSJ-R32729
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the TFPI2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
Western blot testing of 1) mouse spleen, 2) human HeLa, 3) human placenta and 4) human MCF7 lysate with TFPI2 antibody at 0.5ug/ml. Expected molecular weight: ~27 kDa (unmodified), 30-35 kDa (glycosylated).
2 / 4
IHC testing of FFPE human placental tissue with TFPI2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 4
Flow cytometry testing of human A549 cells with TFPI2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TFPI2 antibody.
4 / 4
Flow cytometry testing of human U-87 MG cells with TFPI2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TFPI2 antibody.

Western blot testing of 1) mouse spleen, 2) human HeLa, 3) human placenta and 4) human MCF7 lysate with TFPI2 antibody at 0.5ug/ml. Expected molecular weight: ~27 kDa (unmodified), 30-35 kDa (glycosylated).
IHC testing of FFPE human placental tissue with TFPI2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Flow cytometry testing of human A549 cells with TFPI2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TFPI2 antibody.
Flow cytometry testing of human U-87 MG cells with TFPI2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TFPI2 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32729-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the TFPI2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 70-105 (EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ) from the human protein were used as the immunogen for the TFPI2 antibody.
Limitation:
This TFPI2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
P48307