NSJ Bioreagents

TECTA Antibody (Alpha Tectorin)

Product Code:
 
NSJ-R32651
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the TECTA antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
Western blot testing of 1) rat testis, 2) mouse Hepa1-6 and 3) human HepG2 lysate with TECTA antibody at 0.5ug/ml. Predicted molecular weight: ~240 kDa.
2 / 4
IHC testing of FFPE human intestinal cancer tissue with TECTA antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 4
IHC testing of FFPE human lung cancer tissue with TECTA antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 4
IHC testing of FFPE human testis tissue with TECTA antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
❮❯

Western blot testing of 1) rat testis, 2) mouse Hepa1-6 and 3) human HepG2 lysate with TECTA antibody at 0.5ug/ml. Predicted molecular weight: ~240 kDa.
IHC testing of FFPE human intestinal cancer tissue with TECTA antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with TECTA antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human testis tissue with TECTA antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32651-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the TECTA antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Alpha Tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 93-134 (RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) from human Alpha Tectorin were used as the immunogen for the TECTA antibody.
Limitation:
This TECTA antibody is available for research use only.
Localization:
Membrane, cytoplasm
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O75443