NSJ Bioreagents

Talin 2 Antibody / TLN2

Product Code:
 
NSJ-R32413
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Talin 2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
Western blot testing of 1) rat brain, 2) mouse heart and 3) human SMMC-7721 lysate with Talin 2 antibody. Expected/observed molecular weight ~271 kDa.
2 / 4
IHC testing of FFPE human intestinal cancer tissue with Talin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.
3 / 4
IHC testing of FFPE mouse intestine with Talin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.
4 / 4
IHC testing of FFPE rat intestine with Talin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.

Western blot testing of 1) rat brain, 2) mouse heart and 3) human SMMC-7721 lysate with Talin 2 antibody. Expected/observed molecular weight ~271 kDa.
IHC testing of FFPE human intestinal cancer tissue with Talin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.
IHC testing of FFPE mouse intestine with Talin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.
IHC testing of FFPE rat intestine with Talin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32413-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the Talin 2 antibody should be determined by the researcher.
Description:
Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV were used as the immunogen for the Talin 2 antibody.
Limitation:
This Talin 2 antibody is available for research use only.
Localization:
Cytoplasmic, membranous
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9Y4G6