NSJ Bioreagents

STMN1 Antibody / Stathmin 1

Product Code:
 
NSJ-R31986
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Stathmin 1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 11
Immunofluorescent staining of FFPE human MCF-7 cells with Stathmin 1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 11
IHC testing of FFPE human breast cancer tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 11
IHC testing of FFPE human intestinal cancer tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
4 / 11
IHC testing of FFPE human placental tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
5 / 11
IHC testing of FFPE mouse testis with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
6 / 11
IHC testing of FFPE mouse brain tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
7 / 11
IHC testing of FFPE rat brain tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
8 / 11
Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) mouse testis, 5) human MDA-MB-453, 6) human SH-SY5Y and 7) human Raji lysate with Stathmin 1 antibody. Expected molecular weight ~17 kDa.
9 / 11
Flow cytometry testing of human ThP-1 cells with Stathmin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Stathmin 1 antibody.
10 / 11
Flow cytometry testing of mouse RAW264.7 cells with Stathmin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Stathmin 1 antibody.
11 / 11
Flow cytometry testing of rat RH-35 cells with Stathmin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Stathmin 1 antibody.

Immunofluorescent staining of FFPE human MCF-7 cells with Stathmin 1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human breast cancer tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human intestinal cancer tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human placental tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse testis with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse brain tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain tissue with Stathmin 1 antibody. HIER: Boil the paraffin sections in pH 8 EDTA for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) mouse testis, 5) human MDA-MB-453, 6) human SH-SY5Y and 7) human Raji lysate with Stathmin 1 antibody. Expected molecular weight ~17 kDa.
Flow cytometry testing of human ThP-1 cells with Stathmin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Stathmin 1 antibody.
Flow cytometry testing of mouse RAW264.7 cells with Stathmin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Stathmin 1 antibody.
Flow cytometry testing of rat RH-35 cells with Stathmin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Stathmin 1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31986-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Stathmin 1 antibody should be determined by the researcher.
Description:
Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ASSDIQVKELEKRASGQAFELILSPRSKESVPE of human STMN1 were used as the immunogen for the Stathmin 1 antibody.
Limitation:
This Stathmin 1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P16949