NSJ Bioreagents

RBX1 Antibody / ROC1

Product Code:
 
NSJ-R32161
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the RBX1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of 1) rat testis, 2) rat brain, 3) mouse brain and 4) mouse spleen lysate with RBX1 antibody. Expected molecular weight: 12-15 kDa.
2 / 3
Immunofluorescent staining of FFPE human HeLa cells with RBX1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
3 / 3
Flow cytometry testing of human A431 cells with RBX1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RBX1 antibody.

Western blot testing of 1) rat testis, 2) rat brain, 3) mouse brain and 4) mouse spleen lysate with RBX1 antibody. Expected molecular weight: 12-15 kDa.
Immunofluorescent staining of FFPE human HeLa cells with RBX1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human A431 cells with RBX1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RBX1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32161-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the RBX1 antibody should be determined by the researcher.
Description:
RING-box protein 1, also known as ROC1, is a protein that in humans is encoded by the RBX1 gene. This gene is mapped to chromosome 22q13.2 based on an alignment of the RBX1 sequence with the genomic sequence. ROC1 is recruited by cullin-1 to form a quaternary SCF (HOS)-ROC1 holoenzyme (with SKP1 and the BTRCP homolog HOS). SCF (HOS)-ROC1 binds IKK-beta-phosphorylated I-kappa-B-alpha and catalyzes its ubiquitination in the presence of ubiquitin, E1, and CDC34. Conclusively, ROC1 plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH of human ROC1/RBX1 were used as the immunogen for the RBX1 antibody.
Limitation:
This RBX1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P62877