NSJ Bioreagents

RBBP4 Antibody / RbAp48 / NURF55

Product Code:
 
NSJ-R32202
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Frozen Section (IHC-F)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the RBBP4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 10
Immunofluorescent staining of FFPE human A431 cells with RBBP4 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 10
IHC testing of FFPE human intestinal cancer tissue with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 10
IHC testing of FFPE mouse liver with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 10
IHC testing of FFPE rat intestine with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 10
IHC testing of frozen human placental tissue with RBBP4 antibody.
6 / 10
IHC testing of frozen mouse small intestine tissue with RBBP4 antibody.
7 / 10
IHC testing of frozen mouse liver tissue with RBBP4 antibody.
8 / 10
IHC testing of frozen rat small intestine tissue with RBBP4 antibody.
9 / 10
Western blot testing of 1) rat brain, 2) mouse liver, 3) mouse lung, 4) human HeLa, 5) human Jurkat with RBBP4 antibody. Expected molecular weight: 48~55 kDa.
10 / 10
Flow cytometry testing of human 293T cells with RBBP4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RBBP4 antibody.

Immunofluorescent staining of FFPE human A431 cells with RBBP4 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human intestinal cancer tissue with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse liver with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of frozen human placental tissue with RBBP4 antibody.
IHC testing of frozen mouse small intestine tissue with RBBP4 antibody.
IHC testing of frozen mouse liver tissue with RBBP4 antibody.
IHC testing of frozen rat small intestine tissue with RBBP4 antibody.
Western blot testing of 1) rat brain, 2) mouse liver, 3) mouse lung, 4) human HeLa, 5) human Jurkat with RBBP4 antibody. Expected molecular weight: 48~55 kDa.
Flow cytometry testing of human 293T cells with RBBP4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RBBP4 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32202-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunohistochemistry (Frozen): 0.5-1ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the RBBP4 antibody should be determined by the researcher.
Description:
Retinoblastoma binding protein 4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody.
Limitation:
This RBBP4 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q09028