NSJ Bioreagents

PPT1 Antibody

Product Code:
 
NSJ-R32123
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the PPT1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Western blot testing of 1) rat brain, 2) mouse brain, 3) rat liver, 4) mouse liver, 5) human HepG2, 6) human 293T and 7) MCF-7 lysate with PPT1 antibody. Expected/observed molecular weight ~34 kDa.
2 / 5
IHC testing of FFPE human intestinal cancer tissue with PPT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 5
Flow cytometry testing of human SiHa cells with PPT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.
4 / 5
Flow cytometry testing of human U937 cells with PPT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.
5 / 5
Flow cytometry testing of human THP-1 cells with PPT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.

Western blot testing of 1) rat brain, 2) mouse brain, 3) rat liver, 4) mouse liver, 5) human HepG2, 6) human 293T and 7) MCF-7 lysate with PPT1 antibody. Expected/observed molecular weight ~34 kDa.
IHC testing of FFPE human intestinal cancer tissue with PPT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human SiHa cells with PPT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.
Flow cytometry testing of human U937 cells with PPT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.
Flow cytometry testing of human THP-1 cells with PPT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32123-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the PPT1 antibody should be determined by the researcher.
Description:
Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.
Limitation:
This PPT1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P50897