NSJ Bioreagents

POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase

Product Code:
 
NSJ-R31983
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the POR antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 7
Western blot testing of 1) rat liver, 2) human placenta, 3) human HepG2 and 4) mouse HEPA1-6 lysate with POR antibody. Predicted molecular weight: ~77 kDa, observed here at ~85 kDa.
2 / 7
IHC testing of FFPE human breast cancer with POR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 7
IHC testing of FFPE mouse intestine with POR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 7
IHC testing of FFPE rat intestine with POR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 7
Flow cytometry testing of human A549 cells with POR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=POR antibody.
6 / 7
Flow cytometry testing of human K562 cells with POR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=POR antibody.
7 / 7
Flow cytometry testing of human SiHa cells with POR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=POR antibody.

Western blot testing of 1) rat liver, 2) human placenta, 3) human HepG2 and 4) mouse HEPA1-6 lysate with POR antibody. Predicted molecular weight: ~77 kDa, observed here at ~85 kDa.
IHC testing of FFPE human breast cancer with POR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with POR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with POR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human A549 cells with POR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=POR antibody.
Flow cytometry testing of human K562 cells with POR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=POR antibody.
Flow cytometry testing of human SiHa cells with POR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=POR antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31983-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the POR antibody should be determined by the researcher.
Description:
POR is a membrane-bound enzyme required for electron transfer from NADPH to Cytochrome p450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal p450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined p450C17 and p450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK of human Cytochrome P450 Oxidoreductase were used as the immunogen for the POR antibody.
Limitation:
This POR antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P16435