NSJ Bioreagents

PIAS3 Antibody

Product Code:
 
NSJ-RQ4115
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the PIAS3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of human 1) HeLa, 2) U-87 MG, 3) COLO320, 4) HepG2, 5) rat brain and 6) mouse NIH3T3 lysate with PIAS3 antibody at 0.5ug/ml. Predicted molecular weight ~68 kDa.

Western blot testing of human 1) HeLa, 2) U-87 MG, 3) COLO320, 4) HepG2, 5) rat brain and 6) mouse NIH3T3 lysate with PIAS3 antibody at 0.5ug/ml. Predicted molecular weight ~68 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4115-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the PIAS3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
E3 SUMO-protein ligase PIAS3 is an enzyme that in humans is encoded by the PIAS3 gene. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF from the human protein were used as the immunogen for the PIAS3 antibody.
Limitation:
This PIAS3 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9Y6X2