NSJ Bioreagents

PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

Product Code:
 
NSJ-R32144
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the PAR2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of human 1) HeLa, 2) COLO320, 3) SW620, 4) HepG2 lysate with PAR2 antibody. Expected molecular weight: 33-48 kDa (unmodified), 55-100 kDa (glycosylated). (Ref 1)
❮❯

Western blot testing of human 1) HeLa, 2) COLO320, 3) SW620, 4) HepG2 lysate with PAR2 antibody. Expected molecular weight: 33-48 kDa (unmodified), 55-100 kDa (glycosylated). (Ref 1)

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32144-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the PAR2 antibody should be determined by the researcher.
Description:
Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.
Limitation:
This PAR2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P55085