NSJ Bioreagents

PAR1 Antibody / F2R / Thrombin Receptor

Product Code:
 
NSJ-R32032
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Thrombin Receptor antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human 1) MCF7, 2) HeLa, 3) 22RV1 and 4) SW620 cell lysate with Thrombin Receptor antibody. Expected/observed molecular weight ~47 kDa.~
2 / 2
IHC testing of FFPE human placenta with Thrombin Receptor antibody. HIER: Boil the para

Western blot testing of human 1) MCF7, 2) HeLa, 3) 22RV1 and 4) SW620 cell lysate with Thrombin Receptor antibody. Expected/observed molecular weight ~47 kDa.~
IHC testing of FFPE human placenta with Thrombin Receptor antibody. HIER: Boil the para

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32032-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the Thrombin Receptor antibody should be determined by the researcher.
Description:
Proteinase-activated receptor 1 (PAR-1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK of human PAR-1/Thrombin Receptor were used as the immunogen for the Thrombin Receptor antibody.
Limitation:
This Thrombin Receptor antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P25116