NSJ Bioreagents

NKCC2 Antibody / SLC12A1

Product Code:
 
NSJ-R32222
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the SLC12A1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
IHC testing of FFPE human kidney cancer with SLC12A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
2 / 4
IHC testing of FFPE mouse kidney with SLC12A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
IHC testing of FFPE rat kidney with SLC12A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 4
Western blot testing of 1) monkey kidney, 2) rat kidney and 3) mouse kidney lysate with SLC12A1 antibody. Expected molecular weight: 121-160 kDa depending on glycosylation level. It can also be observed as an ~300 kDa complex with NKCC1.

IHC testing of FFPE human kidney cancer with SLC12A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse kidney with SLC12A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat kidney with SLC12A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) monkey kidney, 2) rat kidney and 3) mouse kidney lysate with SLC12A1 antibody. Expected molecular weight: 121-160 kDa depending on glycosylation level. It can also be observed as an ~300 kDa complex with NKCC1.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32222-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the SLC12A1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1 were used as the immunogen for the SLC12A1 antibody.
Limitation:
This SLC12A1 antibody is available for research use only.
Localization:
Membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat, Monkey
Uniprot #:
Q13621