NSJ Bioreagents

HNRNPA2B1 Antibody

Product Code:
 
NSJ-RQ4393
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the HNRNPA2B1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 6
Immunofluorescent staining of FFPE human U-2 OS cells with HNRNPA2B1 antibody (red) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
Western blot testing of human 1) HeLa, 2) placenta, 3) MDA-MB-453, 4) SW620, 5) HepG2, 6) 22RV1, 7) A431 and 8) A375 lysate with HNRNPA2B1 antibody at 0.5ug/ml. Predicted molecular weight: ~36 kDa.
3 / 6
Flow cytometry testing of human A431 cells with HNRNPA2B1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HNRNPA2B1 antibody.
4 / 6
IHC staining of FFPE human intestinal cancer with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 6
IHC staining of FFPE mouse brain with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 6
IHC staining of FFPE rat brain with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Immunofluorescent staining of FFPE human U-2 OS cells with HNRNPA2B1 antibody (red) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) placenta, 3) MDA-MB-453, 4) SW620, 5) HepG2, 6) 22RV1, 7) A431 and 8) A375 lysate with HNRNPA2B1 antibody at 0.5ug/ml. Predicted molecular weight: ~36 kDa.
Flow cytometry testing of human A431 cells with HNRNPA2B1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HNRNPA2B1 antibody.
IHC staining of FFPE human intestinal cancer with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4393-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the HNRNPA2B1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Heterogeneous nuclear ribonucleoproteins A2/B1 is a protein that in humans is encoded by the HNRNPA2B1 gene. This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKL from the human protein were used as the immunogen for the HNRNPA2B1 antibody.
Limitation:
This HNRNPA2B1 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P22626