NSJ Bioreagents

HMGB2 Antibody

Product Code:
 
NSJ-R32439
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
Prior to reconstitution, store at 40. After reconstitution, the HMGB2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 9
Western blot testing of 1) rat liver and 2) human placenta lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.
2 / 9
IHC testing of FFPE human intestinal cancer tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
3 / 9
IHC testing of FFPE mouse intestine tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
4 / 9
IHC testing of FFPE rat spleen tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
5 / 9
IF/ICC staining of FFPE human U-2 OS cells with HMGB2 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
6 / 9
Flow cytometry testing of human A431 cells with HMGB2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB2 antibody.
7 / 9
Immunofluorescent staining of FFPE human MCF7 cells with HMGB2 antibody (green) and Alpha Tubulin antibody (red). HIER: steam section in pH6 citrate buffer for 20 min.
8 / 9
Western blot testing of 1) human Jurkat, 2) rat PC-12 and 3) mouse spleen lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.
9 / 9
Immunofluorescent staining of FFPE rat intestine tissue with HMGB2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

Western blot testing of 1) rat liver and 2) human placenta lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.
IHC testing of FFPE human intestinal cancer tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IHC testing of FFPE mouse intestine tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IHC testing of FFPE rat spleen tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IF/ICC staining of FFPE human U-2 OS cells with HMGB2 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human A431 cells with HMGB2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB2 antibody.
Immunofluorescent staining of FFPE human MCF7 cells with HMGB2 antibody (green) and Alpha Tubulin antibody (red). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human Jurkat, 2) rat PC-12 and 3) mouse spleen lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.
Immunofluorescent staining of FFPE rat intestine tissue with HMGB2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32439-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence/Immunocytochemistry (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody.
Limitation:
This HMGB2 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P26583