NSJ Bioreagents

GRIN1 Antibody / NMDAR1

Product Code:
 
NSJ-RQ4092
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the GRIN1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of rat brain lysate with GRIN1 antibody at 0.5ug/ml. Predicted molecular weight ~105 kDa.
❮❯

Western blot testing of rat brain lysate with GRIN1 antibody at 0.5ug/ml. Predicted molecular weight ~105 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4092-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the GRIN1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK from the human protein were used as the immunogen for the GRIN1 antibody.
Limitation:
This GRIN1 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Rat
Uniprot #:
Q05586