NSJ Bioreagents

DNA Polymerase iota Antibody / POLI

Product Code:
 
NSJ-RQ4298
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the DNA Polymerase iota antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human 1) HeLa, 2) placenta, 3) A549 and 4) SK-OV-3 lysate with DNA Polymerase iota antibody at 0.5ug/ml. Predicted molecular weight ~83 kDa.
2 / 2
Western blot testing of rat 1) testis, 2) testis, 3) kidney, 4) stomach and mouse 5) testis, 6) testis, 7) kidney and 8) stomach lysate with DNA Polymerase iota antibody at 0.5ug/ml. Predicted molecular weight ~83 kDa.

Western blot testing of human 1) HeLa, 2) placenta, 3) A549 and 4) SK-OV-3 lysate with DNA Polymerase iota antibody at 0.5ug/ml. Predicted molecular weight ~83 kDa.
Western blot testing of rat 1) testis, 2) testis, 3) kidney, 4) stomach and mouse 5) testis, 6) testis, 7) kidney and 8) stomach lysate with DNA Polymerase iota antibody at 0.5ug/ml. Predicted molecular weight ~83 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4298-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the DNA Polymerase iota antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody.
Limitation:
This DNA Polymerase iota antibody is available for research use only.
Localization:
Nucleus
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9UNA4