NSJ Bioreagents

DARPP-32 Antibody

Product Code:
 
NSJ-R32345
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the DARPP-32 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 6
Western blot testing of 1) human Caco-2, 2) rat brain and 3) mouse brain tissue lysate with DARPP-32 antibody. Expected molecular weight ~32 kDa.
2 / 6
IHC testing of FFPE human lung cancer tissue with DARPP-32 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 6
IHC testing of FFPE mouse pancreas with DARPP-32 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 6
IHC testing of FFPE rat intestine with DARPP-32 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 6
Flow cytometry testing of human ThP-1 cells with DARPP-32 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DARPP-32 antibody.
6 / 6
Flow cytometry testing of human PC-3 cells with DARPP-32 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DARPP-32 antibody.
❮❯

Western blot testing of 1) human Caco-2, 2) rat brain and 3) mouse brain tissue lysate with DARPP-32 antibody. Expected molecular weight ~32 kDa.
IHC testing of FFPE human lung cancer tissue with DARPP-32 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse pancreas with DARPP-32 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with DARPP-32 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human ThP-1 cells with DARPP-32 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DARPP-32 antibody.
Flow cytometry testing of human PC-3 cells with DARPP-32 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DARPP-32 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32345-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the DARPP-32 antibody should be determined by the researcher.
Description:
Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP-32 were used as the immunogen for the DARPP-32 antibody.
Limitation:
This DARPP-32 antibody is available for research use only.
Localization:
Cytoplasmic, minor nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9UD71