NSJ Bioreagents

c-Rel Antibody / REL

Product Code:
 
NSJ-R31972
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the c-Rel antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Western blot testing of 1) rat kidney and 2) human HeLa lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.
2 / 5
IHC testing of human breast cancer tissue with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 5
IHC testing of mouse intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 5
IHC testing of rat intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 5
Western blot testing of 1) rat kidney and 2) human HeLa lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.

Western blot testing of 1) rat kidney and 2) human HeLa lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.
IHC testing of human breast cancer tissue with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of mouse intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of rat intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) rat kidney and 2) human HeLa lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31972-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the c-Rel antibody should be determined by the researcher.
Description:
The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody.
Limitation:
This c-Rel antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P15307