NSJ Bioreagents

AQP2 Antibody / Aquaporin 2

Product Code:
 
NSJ-R32091
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Aquaporin 2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Flow cytometry testing of human PC-3 cells with Aquaporin 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Aquaporin 2 antibody.
2 / 5
IHC testing of FFPE human kidney cancer tissue with Aquaporin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 5
IHC testing of FFPE mouse kidney with Aquaporin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 5
IHC testing of FFPE rat kidney with Aquaporin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 5
Western blot testing of 1) rat kidney, 2) rat NRK, 3) rat PC-12, 4) mouse kidney, 5) mouse HBZY and 6) mouse RAW264.7 cell lysate with Aquaporin 2 antibody. Observed molecular weight: 29-46 kDa depending on glycosylation level.

Flow cytometry testing of human PC-3 cells with Aquaporin 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Aquaporin 2 antibody.
IHC testing of FFPE human kidney cancer tissue with Aquaporin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse kidney with Aquaporin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat kidney with Aquaporin 2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) rat kidney, 2) rat NRK, 3) rat PC-12, 4) mouse kidney, 5) mouse HBZY and 6) mouse RAW264.7 cell lysate with Aquaporin 2 antibody. Observed molecular weight: 29-46 kDa depending on glycosylation level.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32091-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the Aquaporin 2 antibody should be determined by the researcher.
Description:
AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell. The AQP2 gene is mapped to chromosome 12q13, very close to the site of major intrinsic protein by situ hybridization. The investigators suggested that a defect in the AQP2 gene is the basis of the autosomal form of nephrogenic diabetes insipidus. The functional expression and the limited localization suggested that AQP2 is the vasopressin-regulated water channel. Using rat kidney slices and porcine kidney cells stably expressing rat Aqp2, AQP2 trafficking can be stimulated by cAMP-independent pathways that utilize nitric oxide (NO). The NO donors sodium nitroprusside (SNP) and NONOate and the NO synthase substrate L-arginine mimicked the effect of vasopressin (VP), stimulating relocation of Aqp2 from cytoplasmic vesicles to the apical plasma membrane. SNP increased intracellular cGMP rather than cAMP, and exogenous cGMP stimulated AQP2 membrane insertion. Atrial natriuretic factor, which signals via cGMP, also stimulated AQP2 translocation. AQP2 expression in kidney connecting tubules is sufficient for survival and that AQP2 expression in collecting ducts is required to regulate body water balance. The S256L substitution in the cytoplasmic tail of the Aqp2 protein prevented phosphorylation at S256 and the subsequent accumulation of Aqp2 on the apical membrane of the collecting duct principal cells.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EPDTDWEEREVRRRQSVELHSPQSLPRGTKA of human Aquaporin 2 were used as the immunogen for the Aquaporin 2 antibody.
Limitation:
This Aquaporin 2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P41181