NSJ Bioreagents

Alpha Amylase 1 Antibody

Product Code:
 
NSJ-R32663
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Alpha Amylase antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
IHC testing of human pancreatic cancer tissue with Alpha Amylase antibody at 0.5ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.~
2 / 2
Western blot testing of 1) rat pancreas and 2) mouse pancreas

IHC testing of human pancreatic cancer tissue with Alpha Amylase antibody at 0.5ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.~
Western blot testing of 1) rat pancreas and 2) mouse pancreas

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32663-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Alpha Amylase antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein were used as the immunogen for the Alpha Amylase antibody.
Limitation:
This Alpha Amylase antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P04745