NSJ Bioreagents

ALDH7A1 Antibody

Product Code:
 
NSJ-R32506
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ALDH7A1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 6
Western blot testing of 1) rat liver, 2) mouse HEPA and 3) human HeLa lysate with ALDH7A1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.
2 / 6
IHC testing of FFPE human lung with ALDH7A1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
3 / 6
IHC testing of FFPE rat brain with ALDH7A1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
4 / 6
IF/ICC staining of FFPE human U-2 OS cells with ALDH7A1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
5 / 6
IF/ICC staining of FFPE human U-2 OS cells with ALDH7A1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
6 / 6
Flow cytometry testing of permeabilized human A431 cells with ALDH7A1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALDH7A1 antibody.

Western blot testing of 1) rat liver, 2) mouse HEPA and 3) human HeLa lysate with ALDH7A1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.
IHC testing of FFPE human lung with ALDH7A1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat brain with ALDH7A1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human U-2 OS cells with ALDH7A1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human U-2 OS cells with ALDH7A1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of permeabilized human A431 cells with ALDH7A1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALDH7A1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32506-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence/Immunocytochemistry (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody.
Limitation:
This ALDH7A1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P49419