NSJ Bioreagents

ABCC8 Antibody / SUR1

Product Code:
 
NSJ-RQ4054
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
 
After reconstitution, the SUR1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of 1) human placenta, 2) rat brain and 3) mouse brain lysate with SUR1 antibody at 0.5ug/ml. Predicted molecular weight ~177 kDa.
2 / 2
Flow cytometry testing of human A431 cells with SUR1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=SUR1 antibody.

Western blot testing of 1) human placenta, 2) rat brain and 3) mouse brain lysate with SUR1 antibody at 0.5ug/ml. Predicted molecular weight ~177 kDa.
Flow cytometry testing of human A431 cells with SUR1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=SUR1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4054-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the SUR1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA from the human protein were used as the immunogen for the SUR1 antibody.
Limitation:
This SUR1 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q09428