NSJ Bioreagents

TRPV3 Antibody

Product Code:
 
NSJ-RQ7109
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the TRPV3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of human 1) MDA-MB-453, 2) PC-3, 3) Caco-2 and 4) HeLa cell lysate with TRPV3 antibody. Predicted molecular weight ~90 kDa.

Western blot testing of human 1) MDA-MB-453, 2) PC-3, 3) Caco-2 and 4) HeLa cell lysate with TRPV3 antibody. Predicted molecular weight ~90 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7109-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the TRPV3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Transient receptor potential cation channel, subfamily V, member 3, also known as TRPV3, is a human gene encoding the protein of the same name. This gene product belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels. Multiple transcript variants encoding different isoforms have been found for this gene.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids VRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV were used as the immunogen for the TRPV3 antibody.
Limitation:
This TRPV3 antibody is available for research use only.
Purity:
Antigen affinity purified
Uniprot #:
Q8NET8

Documents