NSJ Bioreagents

UHRF2 Antibody / NIRF (Antigen affinity purified)

Product Code:
 
NSJ-RQ6582
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
6B5
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
 
After reconstitution, the NIRF antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 4
Immunofluorescent staining of FFPE human HeLa cells with NIRF antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 4
Flow cytometry testing of human HeLa cells with NIRF antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NIRF antibody.
3 / 4
Flow cytometry testing of rat RH35 cells with NIRF antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NIRF antibody.
4 / 4
Western blot testing of human 1) HepG2, 2) HT1080 and 3) Jurkat cell lysate with NIRF antibody. Expected molecular weight ~90 kDa.
❮❯

Immunofluorescent staining of FFPE human HeLa cells with NIRF antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human HeLa cells with NIRF antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NIRF antibody.
Flow cytometry testing of rat RH35 cells with NIRF antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NIRF antibody.
Western blot testing of human 1) HepG2, 2) HT1080 and 3) Jurkat cell lysate with NIRF antibody. Expected molecular weight ~90 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6582-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 1-2ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the NIRF antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
N-terminal region amino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN from the human protein were used as the immunogen for the NIRF antibody.
Limitation:
This NIRF antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity purified
Uniprot #:
Q96PU4

Documents