NSJ Bioreagents

Cofilin 2 Antibody / CFL2

Product Code:
 
NSJ-RQ5498
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
8C13
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunocytochemistry (ICC)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Cofilin 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 8
Immunofluorescent staining of FFPE human U-2 OS cells with Cofilin 2 antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
2 / 8
IHC staining of FFPE human skeletal muscle with Cofilin 2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE mouse skeletal muscle with Cofilin 2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
4 / 8
IHC staining of FFPE rat skeletal muscle with Cofilin 2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
5 / 8
Western blot testing of human 1) HeLa, 2) U-2 OS, 3) HepG2, 4) T-47D, 5) Raji, 6) placenta and 7) A549 lysate with Cofilin 2 antibody. Predicted molecular weight ~19 kDa.
6 / 8
Western blot testing of 1) rat heart, 2) rat liver, 3) rat kidney, 4) rat brain, 5) mouse heart, 6) mouse liver, 7) mouse kidney, 8) mouse brain and 9) mouse NIH3T3 lysate with Cofilin 2 antibody. Predicted molecular weight ~19 kDa.
7 / 8
Flow cytometry testing of human A549 cells with Cofilin 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cofilin 2 antibody.
8 / 8
Flow cytometry testing of human SiHa cells with Cofilin 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cofilin 2 antibody.

Immunofluorescent staining of FFPE human U-2 OS cells with Cofilin 2 antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human skeletal muscle with Cofilin 2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE mouse skeletal muscle with Cofilin 2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat skeletal muscle with Cofilin 2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Western blot testing of human 1) HeLa, 2) U-2 OS, 3) HepG2, 4) T-47D, 5) Raji, 6) placenta and 7) A549 lysate with Cofilin 2 antibody. Predicted molecular weight ~19 kDa.
Western blot testing of 1) rat heart, 2) rat liver, 3) rat kidney, 4) rat brain, 5) mouse heart, 6) mouse liver, 7) mouse kidney, 8) mouse brain and 9) mouse NIH3T3 lysate with Cofilin 2 antibody. Predicted molecular weight ~19 kDa.
Flow cytometry testing of human A549 cells with Cofilin 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cofilin 2 antibody.
Flow cytometry testing of human SiHa cells with Cofilin 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cofilin 2 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ5498-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml, Immunocytochemistry/Immunofluorescence: 2-4ug/ml, Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Cofilin 2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody.
Limitation:
This Cofilin 2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9Y281