NSJ Bioreagents

HMGB3 Antibody / HMG4

Product Code:
 
NSJ-RQ6029
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
7G13
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the HMGB3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 4
IHC staining of FFPE human placenta with HMGB3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 4
Immunofluorescent staining of FFPE human HeLa cells with HMGB3 antibody. HIER: steam section in pH6 citrate buffer for 20 min.
3 / 4
Western blot testing of human 1) placenta, 2) HeLa, 3) T-47D, 4) A431, 5) HepG2, 6) Caco-2, 7) SW620 and 8) Raji lysate with HMGB3 antibody. Predicted molecular weight ~23 kDa.
4 / 4
Flow cytometry testing of human HeLa cells with HMGB3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB3 antibody.

IHC staining of FFPE human placenta with HMGB3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human HeLa cells with HMGB3 antibody. HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) placenta, 2) HeLa, 3) T-47D, 4) A431, 5) HepG2, 6) Caco-2, 7) SW620 and 8) Raji lysate with HMGB3 antibody. Predicted molecular weight ~23 kDa.
Flow cytometry testing of human HeLa cells with HMGB3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB3 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6029-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the HMGB3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMGB3 antibody.
Limitation:
This HMGB3 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
O15347