NSJ Bioreagents

Fibrinogen beta chain Antibody (FGB)

Product Code:
 
NSJ-RQ6233
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
6D12
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the FGB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 2
IHC staining of FFPE human liver cancer with FGB antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 2
Western blot testing of human HepG2 cell lysate with FGB antibody. Predicted molecular weight ~56 kDa.
❮❯

IHC staining of FFPE human liver cancer with FGB antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human HepG2 cell lysate with FGB antibody. Predicted molecular weight ~56 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6233-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml
Application Note:
Optimal dilution of the FGB antibody should be determined by the researcher.
Description:
Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT from the human protein were used as the immunogen for the FGB antibody.
Limitation:
This FGB antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
P02675