NSJ Bioreagents

MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1

Product Code:
 
NSJ-RQ4944
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Antibody Clone:
 
n/a
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
 
After reconstitution, the MCUR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 6
Western blot testing of human 1) HeLa, 2) MDA-MB-231, 3) HL-60, 4) MDA-MB-453, 5) A431, 6) Caco-2, 7) rat spleen, 8) mouse lung and 9) mouse ANA-1 lysate with MCUR1 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.
2 / 6
IHC staining of FFPE human tonsil tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE human placenta tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE human lung cancer tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
5 / 6
IHC staining of FFPE human esophageal squamous cancer with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
6 / 6
IHC staining of FFPE human ovarian cancer tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

Western blot testing of human 1) HeLa, 2) MDA-MB-231, 3) HL-60, 4) MDA-MB-453, 5) A431, 6) Caco-2, 7) rat spleen, 8) mouse lung and 9) mouse ANA-1 lysate with MCUR1 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.
IHC staining of FFPE human tonsil tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human placenta tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human esophageal squamous cancer with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer tissue with MCUR1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4944-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the MCUR1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca(2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT). The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE from the human protein were used as the immunogen for the MCUR1 antibody.
Limitation:
This MCUR1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q96AQ8