NSJ Bioreagents

MRP2 Antibody / ABCC2

Product Code:
 
NSJ-RQ4941
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Antibody Clone:
 
n/a
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
 
After reconstitution, the MRP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 7
Western blot testing of human Caco-2 lysate with MRP2 antibody at 0.5ug/ml. Predicted molecular weight: 174-250 kDa depending on degree of glycosylation.
2 / 7
IHC staining of FFPE human liver cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE human rectal cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE human lung cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
5 / 7
IHC staining of FFPE human breast cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
6 / 7
IHC staining of FFPE mouse liver with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
7 / 7
IHC staining of FFPE mouse kidney with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

Western blot testing of human Caco-2 lysate with MRP2 antibody at 0.5ug/ml. Predicted molecular weight: 174-250 kDa depending on degree of glycosylation.
IHC staining of FFPE human liver cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human rectal cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE mouse liver with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE mouse kidney with MRP2 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4941-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the MRP2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Multidrug resistance-associated protein 2 (MRP2), also called canalicular multispecific organic anion transporter 1 (cMOAT) or ATP-binding cassette sub-family C member 2 (ABCC2), is a protein that in humans is encoded by the ABCC2 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD from the human protein were used as the immunogen for the MRP2 antibody.
Limitation:
This MRP2 antibody is available for research use only.
Localization:
Plasma membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse
Uniprot #:
Q92887