NSJ Bioreagents

SCN4B Antibody

Product Code:
 
NSJ-RQ4934
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Antibody Clone:
 
n/a
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
 
After reconstitution, the SCN4B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 6
Western blot testing of 1) human placenta, 2) human U-87 MG, 3) monkey COS-7, 4) human U-20 OS, 5) human HEK293, 6) human SHG-44, 7) human K562 and 8) human HL-60 cell lysate with SCN4B antibody at 0.5ug/ml. Predicted molecular weight: 25-38 kDa depending on level of glycosylation.
2 / 6
Western blot testing of 1) rat brain, 2) rat heart, 3) rat spleen, 4) rat kidney, 5) mouse brain, 6) mouse heart, 7) mouse spleen, 8) mouse kidney and 9) mouse Neuro-2a lysate with SCN4B antibody at 0.5ug/ml. Predicted molecular weight: 25-38 kDa depending on level of glycosylation.
3 / 6
IHC staining of FFPE human renal cancer with SCN4B antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE human rat spleen with SCN4B antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
5 / 6
Flow cytometry testing of human U-2 OS cells with SCN4B antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SCN4B antibody.
6 / 6
Flow cytometry testing of human SiHa cells with SCN4B antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SCN4B antibody.

Western blot testing of 1) human placenta, 2) human U-87 MG, 3) monkey COS-7, 4) human U-20 OS, 5) human HEK293, 6) human SHG-44, 7) human K562 and 8) human HL-60 cell lysate with SCN4B antibody at 0.5ug/ml. Predicted molecular weight: 25-38 kDa depending on level of glycosylation.
Western blot testing of 1) rat brain, 2) rat heart, 3) rat spleen, 4) rat kidney, 5) mouse brain, 6) mouse heart, 7) mouse spleen, 8) mouse kidney and 9) mouse Neuro-2a lysate with SCN4B antibody at 0.5ug/ml. Predicted molecular weight: 25-38 kDa depending on level of glycosylation.
IHC staining of FFPE human renal cancer with SCN4B antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human rat spleen with SCN4B antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
Flow cytometry testing of human U-2 OS cells with SCN4B antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SCN4B antibody.
Flow cytometry testing of human SiHa cells with SCN4B antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SCN4B antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4934-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the SCN4B antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Sodium channel beta-subunit 4, also known as SCN4B or Na?4, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ from the human protein were used as the immunogen for the SCN4B antibody.
Limitation:
This SCN4B antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q8IWT1