NSJ Bioreagents

LRIG1 Antibody

Product Code:
 
NSJ-RQ4668
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the LRIG1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human Caco-2 lysate with LRIG1 antibody at 0.5ug/ml. Expected molecular weight: 119-145 kDa depending on glycosylation level. Soluble fragments of 90-105 kDa and 60-70 kDa may also be observed.
2 / 2
IHC staining of FFPE human breast cancer with LRIG1 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Western blot testing of human Caco-2 lysate with LRIG1 antibody at 0.5ug/ml. Expected molecular weight: 119-145 kDa depending on glycosylation level. Soluble fragments of 90-105 kDa and 60-70 kDa may also be observed.
IHC staining of FFPE human breast cancer with LRIG1 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4668-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the LRIG1 antibody should be determined by the researcher.
Description:
Leucine-rich repeats and immunoglobulin-like domains protein 1 is a protein that in humans is encoded by the LRIG1 gene. It encodes a transmembrane protein that has been shown to interact with receptor tyrosine kinases of the EGFR-family, MET and RET. This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI were used as the immunogen for the LRIG1 antibody.
Limitation:
This LRIG1 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
Q96JA1