NSJ Bioreagents

Thrombopoietin Antibody / THPO

Product Code:
 
NSJ-RQ4662
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the Thrombopoietin antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) human HepG2, 2) human Caco-2, 3) rat liver and 4) mouse liver lysate with Thrombopoietin antibody at 0.5ug/ml. Predicted molecular weight: 38 kDa, routinely observed at 40-55 kDa (unmodified), 80-95 kDa (glycosylated).

Western blot testing of 1) human HepG2, 2) human Caco-2, 3) rat liver and 4) mouse liver lysate with Thrombopoietin antibody at 0.5ug/ml. Predicted molecular weight: 38 kDa, routinely observed at 40-55 kDa (unmodified), 80-95 kDa (glycosylated).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4662-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the Thrombopoietin antibody should be determined by the researcher.
Description:
Thrombopoietin (THPO), also known as megakaryocyte growth and development factor (MGDF), is a protein that in humans is encoded by the THPO gene. Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQL were used as the immunogen for the Thrombopoietin antibody.
Limitation:
This Thrombopoietin antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P40225