NSJ Bioreagents

SI Antibody / Sucrase Isomaltase

Product Code:
 
NSJ-RQ4659
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Sucrase Isomaltase antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Western blot testing of human 1) HeLa, 2) COLO-320, 3) SHG-44 and 4) HEK293 lysate with Sucrase Isomaltase antibody at 0.5ug/ml. Predicted molecular weight ~209 kDa.
2 / 5
IHC staining of FFPE mouse intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 5
IHC staining of FFPE rat intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 5
IHC staining of FFPE rat intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
5 / 5
Western blot testing of rat intestine lysate with Sucrase Isomaltase antibody. Predicted molecular weight ~209 kDa.
❮❯

Western blot testing of human 1) HeLa, 2) COLO-320, 3) SHG-44 and 4) HEK293 lysate with Sucrase Isomaltase antibody at 0.5ug/ml. Predicted molecular weight ~209 kDa.
IHC staining of FFPE mouse intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of rat intestine lysate with Sucrase Isomaltase antibody. Predicted molecular weight ~209 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4659-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Sucrase Isomaltase antibody should be determined by the researcher.
Description:
This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.
Limitation:
This Sucrase Isomaltase antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P14410