NSJ Bioreagents

ZP1 Antibody / Zona pellucida sperm-binding protein 1

Product Code:
 
NSJ-R32398
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the ZP1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat ovary and 2) human SKOV lysate with ZP1 antibody. Expected molecular weight: 70/90-110 kDa (unmodified/glycosylated).

Western blot testing of 1) rat ovary and 2) human SKOV lysate with ZP1 antibody. Expected molecular weight: 70/90-110 kDa (unmodified/glycosylated).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32398-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the ZP1 antibody should be determined by the researcher.
Description:
Zona pellucida sperm-binding protein 1 is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD were used as the immunogen for the ZP1 antibody.
Limitation:
This ZP1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P60852